PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_10517_BGI-A2_v1.0
Common NameF383_03254
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 314aa    MW: 34733.7 Da    PI: 8.7632
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_10517_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18225258134
                        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                 C +C +t+Tp+WR+gp g+ktLCnaCG++yr+ +
  Cotton_A_10517_BGI-A2_v1.0 225 CGHCEVTETPQWRKGPMGPKTLCNACGVRYRSGR 258
                                 9******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-16219269IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-14223256IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.648223255IPR000679Zinc finger, GATA-type
CDDcd002028.10E-15224271No hitNo description
SuperFamilySSF577169.03E-15224282No hitNo description
PROSITE patternPS003440225250IPR000679Zinc finger, GATA-type
PfamPF003201.6E-16225258IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MNDDLFDDDV IKYLDLPLED VERIDGGVSG NVIKDFGFPL YDNNGGYGGG SFSGGEECDC  60
NFQHLAGFCG GDFLDDSIVE SLTFSCDGYS QQSSSTKASY SESMDVKGSS WFQTSSPVSV  120
LDSHISSSGA NRIPINPNLS FQGKRCRTNR RRASTLNSPF TLPFVSSTFS TSQRFYFPVG  180
SKSESVSHLS QKPTKKRLKK KNLKLLSGFS ESNNSSSQQL VIRKCGHCEV TETPQWRKGP  240
MGPKTLCNAC GVRYRSGRLF PEYRPAGSPT FIASLHSNSH KKVVEMRRKS QFTGDSNTIR  300
VVNPTETSLR YQLY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461702.11e-154PREDICTED: GATA transcription factor 11-like
TrEMBLA0A0B0NF560.0A0A0B0NF56_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.28e-42GATA transcription factor 11